-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SELENOM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-130 of human SELENOM (NP_536355.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SELENOM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-130 of human SELENOM (NP_536355.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11658A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SELENOM |
| Target Synonyms | SELM; SEPM; SELENOM | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, A-431, Mouse brain, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-130 of human SELENOM (NP_536355.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVW | Uniprot ID | Q8WWX9 |
Uniprot Id
Q8WWX9
Target Species
Human
Target Name
SELENOM
Target Full Name
Selenoprotein M
Target Function
May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation.
Target Subcellular Location
Cytoplasm, perinuclear region. Endoplasmic reticulum. Golgi apparatus. Note=Localized to perinuclear structures corresponding to Golgi and endoplasmic reticulum.
Target Protein Families
Selenoprotein M/F family
Target Tissue Specificity
Widely expressed.
Target Research Area
Others
Target Synonyms
SELENOM; SELM; Selenoprotein M; SelM
Target Background
The protein encoded by this gene belongs to the selenoprotein M/SEP15 family. The exact function of this protein is not known. It is localized in the perinuclear region, is highly expressed in the brain, and may be involved in neurodegenerative disorders. Transgenic mice with targeted deletion of this gene exhibit increased weight gain, suggesting a role for this gene in the regulation of body weight and energy metabolism. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec). Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal.
Notification