Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SEMA4F was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 280-420 of human SEMA4F (NP_004254.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SEMA4F was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 280-420 of human SEMA4F (NP_004254.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06434A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SEMA4F |
| Target Synonyms | S4F; SEMAM; SEMAW; M-SEMA; PRO2353; m-Sema-M; SEMA4F | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, A-549, HepG2, Mouse brain, Mouse liver, Mouse lung, Rat liver, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 280-420 of human SEMA4F (NP_004254.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RKTLQQRWTTFLKADLLCPGPEHGRASSVLQDVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRELKHDCNRGLPVVDNDVPQPRPGECITNNMKLRHFGSSLSLPDRVLTFIRDHPLMDRPVFP | Uniprot ID | O95754 |
Uniprot Id
O95754
Target Species
Human
Target Name
SEMA4F
Target Full Name
Semaphorin-4F
Target Function
Probable cell surface receptor that regulates oligodendroglial precursor cell migration. Might also regulate differentiation of oligodendroglial precursor cells. Has growth cone collapse activity against retinal ganglion-cell axons.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction, synapse, postsynaptic density. Perikaryon. Cell projection, dendrite.
Target Protein Families
Semaphorin family
Target Synonyms
SEMA4F; SEMAM; SEMAW; Semaphorin-4F; Semaphorin-M; Sema M; Semaphorin-W; Sema W
Target Background
This gene encodes a transmembrane class IV semaphorin family protein, which plays a role in neural development. This gene may be involved in neurogenesis in prostate cancer, the development of neurofibromas, and breast cancer tumorigenesis. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
