Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Semaphorin 3A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human Semaphorin 3A (NP_006071.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Semaphorin 3A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human Semaphorin 3A (NP_006071.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09565A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Semaphorin 3A |
| Target Synonyms | HH16; SemD; COLL1; SEMA1; SEMAD; SEMAL; coll-1; Hsema-I; SEMAIII; Hsema-III; Semaphorin 3A | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Semaphorin 3A (NP_006071.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GIDTHFDELQDVFLMNFKDPKNPVVYGVFTTSSNIFKGSAVCMYSMSDVRRVFLGPYAHRDGPNYQWVPYQGRVPYPRPGTCPSKTFGGFDSTKDLPDDVI | Uniprot ID | Q14563 |
Uniprot Id
Q14563
Target Species
Human
Target Name
SEMA3A
Target Full Name
Semaphorin-3A
Target Function
Involved in the development of the olfactory system and in neuronal control of puberty. Induces the collapse and paralysis of neuronal growth cones. Could serve as a ligand that guides specific growth cones by a motility-inhibiting mechanism. Binds to the complex neuropilin-1/plexin-1.
Target Involvement
Hypogonadotropic hypogonadism 16 with or without anosmia (HH16)
Target Subcellular Location
Secreted.
Target Protein Families
Semaphorin family
Target Tissue Specificity
Expressed in the dorsal root ganglia.
Target Synonyms
SEMA3A; SEMAD; Semaphorin-3A; Semaphorin III; Sema III
Target Background
This gene is a member of the semaphorin family and encodes a protein with an Ig-like C2-type (immunoglobulin-like) domain, a PSI domain and a Sema domain. This secreted protein can function as either a chemorepulsive agent, inhibiting axonal outgrowth, or as a chemoattractive agent, stimulating the growth of apical dendrites. In both cases, the protein is vital for normal neuronal pattern development. Increased expression of this protein is associated with schizophrenia and is seen in a variety of human tumor cell lines. Also, aberrant release of this protein is associated with the progression of Alzheimer's disease.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
