Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Septin 3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 179-358 of human Septin 3 (NP_663786.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Septin 3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 179-358 of human Septin 3 (NP_663786.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00208A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Septin 3 |
| Target Synonyms | SEP3; SEPT3; bK250D10.3; Septin 3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 179-358 of human Septin 3 (NP_663786.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE | Uniprot ID | Q9UH03 |
Uniprot Id
Q9UH03
Target Species
Human
Target Name
SEPT3
Target Full Name
Neuronal-specific septin-3
Target Function
Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential).
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Cell junction, synapse.
Target Protein Families
TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, Septin GTPase family
Target Tissue Specificity
Brain-specific.
Target Synonyms
SEP3; SEPT3; bK250D10.3; Septin 3
Target Background
This gene belongs to the septin family of GTPases. Members of this family are required for cytokinesis. Expression is upregulated by retinoic acid in a human teratocarcinoma cell line. The specific function of this gene has not been determined. Alternative splicing of this gene results in several transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
