-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Septin 4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Septin 4 (NP_536341.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Septin 4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Septin 4 (NP_536341.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12289A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Septin 4 |
| Target Synonyms | H5; ARTS; MART; SEP4; CE5B3; SEPT4; PNUTL2; hucep-7; BRADEION; C17orf47; hCDCREL-2; Septin 4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2, SK-MEL-28 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Septin 4 (NP_536341.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSE | Uniprot ID | O43236 |
Uniprot Id
O43236
Target Species
Human
Target Name
SEPT4
Target Full Name
Septin-4
Target Function
Filament-forming cytoskeletal GTPase (Probable). Plays an important role in male fertility and sperm motility. During spermiogenesis, essential for the establishment of the annulus (a fibrous ring structure connecting the midpiece and the principal piece of the sperm flagellum) which is a requisite for the structural and mechanical integrity of the sperm. Involved in the migration of cortical neurons and the formation of neuron leading processes during embryonic development.; Required for the induction of cell death mediated by TGF-beta and possibly by other apoptotic stimuli. Induces apoptosis through binding and inhibition of XIAP resulting in significant reduction in XIAP levels, leading to caspase activation and cell death.
Target Subcellular Location
Cytoplasm. Cell projection, cilium, flagellum. Cytoplasmic vesicle, secretory vesicle. Cell projection, axon. Cell projection, dendrite. Perikaryon.; [Isoform ARTS]: Mitochondrion. Nucleus.
Target Protein Families
TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, Septin GTPase family
Target Tissue Specificity
Widely expressed in adult and fetal tissues with highest expression in adult brain (at protein level), heart, liver and adrenal gland and fetal heart, kidney, liver and lung. Also expressed in colorectal cancers and malignant melanomas. Expressed in plate
Target Synonyms
Apoptosis-related protein in the TGF-beta signaling pathway; ARTS; Bradeion; Bradeion beta; Brain protein H5; CE5B3; CE5B3 beta; Cell division control-related protein 2; Cerebral protein 7; H5; hCDCREL-2; hucep-7; MART; Peanut-like protein 2; PNUTL2; SEP 4; SEP4; Sept4; SEPT4_HUMAN; Septin M; Septin-4
Target Background
This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is highly expressed in brain and heart. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. One of the isoforms (known as ARTS) is distinct; it is localized to the mitochondria, and has a role in apoptosis and cancer.
Notification