-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Septin 8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Septin 8 (NP_001287728.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Septin 8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Septin 8 (NP_001287728.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14582A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Septin 8 |
| Target Synonyms | SEP2; SEPT8; Septin 8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat heart, K-562, Mouse liver, Mouse uterus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Septin 8 (NP_001287728.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAATDLERFSNAEPEPRSLSLGGHVGFDSLPDQLVSKSVTQGFSFNILCVGETGIGKSTLMNTLFNTTFETEEASHHEACVRLRPQTYDLQESNVQLKLT | Uniprot ID | Q92599 |
Uniprot Id
Q92599
Target Species
Human
Target Name
SEPT8
Target Full Name
Septin-8
Target Function
Filament-forming cytoskeletal GTPase. May play a role in platelet secretion. Seems to participate in the process of SNARE complex formation in synaptic vesicles.; Stabilizes BACE1 protein levels and promotes the sorting and accumulation of BACE1 to the recycling or endosomal compartments, modulating the beta-amyloidogenic processing of APP.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Cell junction, synapse. Cell projection, axon. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane. Cell junction, synapse, presynapse.
Target Protein Families
TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, Septin GTPase family
Target Tissue Specificity
Widely expressed, including in brain, heart and platelets; most abundant in aorta. Isoform 2 is expressed at low levels in specific brain areas, such as occipital pole, frontal lobe, temporal lobe and putamen. Isoform 1 and 3 are highly expressed in speci
Target Synonyms
SEPTIN8; KIAA0202; SEPT8; Septin-8
Target Background
This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification