-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SERCA1/ATP2A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 901-1001 of human SERCA1/SERCA1/ATP2A1 (NP_775293.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SERCA1/ATP2A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 901-1001 of human SERCA1/SERCA1/ATP2A1 (NP_775293.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01258A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SERCA1/ATP2A1 |
| Target Synonyms | ATP2A; SERCA1; SERCA1/ATP2A1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C2C12 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 901-1001 of human SERCA1/SERCA1/ATP2A1 (NP_775293.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLTQWLMVLKISLPVIGLDEILKFVARNYLEDPEDERRK | Uniprot ID | O14983 |
Uniprot Id
O14983
Target Species
Human
Target Name
ATP2A1
Target Full Name
Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
Target Function
Key regulator of striated muscle performance by acting as the major Ca(2+) ATPase responsible for the reuptake of cytosolic Ca(2+) into the sarcoplasmic reticulum. Catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.
Target Involvement
Brody myopathy (BRM)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Sarcoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IIA subfamily
Target Tissue Specificity
Skeletal muscle, fast twitch muscle (type II) fibers.
Target Research Area
Cardiovascular
Target Synonyms
fast twitch skeletal muscle isoform; AT2A1_HUMAN; ATP2A; ATP2A1; ATPase Ca++ transporting cardiac muscle fast twitch 1; ATPase Ca++ transporting fast twitch 1; ATPase; Ca(2+)-transporting fast twitch 1; Calcium pump 1; Calcium transporting ATPase sarcoplasmic reticulum type fast twitch skeletal muscle isoform; Calcium-transporting ATPase sarcoplasmic reticulum type; EC 3.6.3.8; Endoplasmic reticulum class 1/2 Ca(2+) ATPase; Fast skeletal muscle SR calcium ATPase; OTTHUMP00000162561; OTTHUMP00000162562; Sarcoendoplasmic reticulum calcium ATPase; Sarcoplasmic reticulum Ca(2+)-ATPase 1; Sarcoplasmic/endoplasmic reticulum calcium ATPase 1; SERCA 1; SERCA1; SERCA1 truncated isoform; included; SR Ca(2+) ATPase 1; SR Ca(2+)-ATPase 1
Target Background
This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in three transcript variants encoding different isoforms.
Notification