Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SERPINA9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-210 of human SERPINA9 (NP_783866.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SERPINA9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-210 of human SERPINA9 (NP_783866.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00554A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SERPINA9 |
| Target Synonyms | GCET1; SERPINA11; SERPINA11b; SERPINA9 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | human serum | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-210 of human SERPINA9 (NP_783866.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQ | Uniprot ID | Q86WD7 |
Uniprot Id
Q86WD7
Target Species
Human
Target Name
SERPINA9
Target Full Name
Serpin A9
Target Function
Protease inhibitor that inhibits trypsin and trypsin-like serine proteases (in vitro). Inhibits plasmin and thrombin with lower efficiency (in vitro).
Target Subcellular Location
[Isoform 1]: Secreted.; [Isoform 2]: Cytoplasm.; [Isoform 3]: Cytoplasm.; [Isoform 4]: Cytoplasm.; [Isoform 5]: Cytoplasm.; [Isoform 6]: Cytoplasm.; [Isoform 7]: Membrane; Single-pass type II membrane protein.
Target Protein Families
Serpin family
Target Tissue Specificity
Highly expressed in normal germinal center (GC) B-cells and GC B-cell-derived malignancies.
Target Research Area
Others
Target Synonyms
Centerin; GCET1; Germinal center B cell expressed transcript 1; Germinal center B-cell-expressed transcript 1 protein; Seprin A9; Serine proteinase inhibitor A11; Serpin A9; Serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 9; Serpin peptidase inhibitor clade A member 9; SERPINA11; SERPINA11b; Serpina9; SPA9_HUMAN
Target Background
Enables serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of endopeptidase activity. Predicted to be located in cytoplasm and membrane. Predicted to be active in extracellular space.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
