-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SERPINB6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-300 of human SERPINB6 (NP_004559.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SERPINB6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-300 of human SERPINB6 (NP_004559.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00854A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SERPINB6 |
| Target Synonyms | CAP; PI6; PTI; PI-6; SPI3; DFNB91; MSTP057; SERPINB6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-300 of human SERPINB6 (NP_004559.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ENTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKA | Uniprot ID | P35237 |
Uniprot Id
P35237
Target Species
Human
Target Name
SERPINB6
Target Full Name
Serpin B6
Target Function
May be involved in the regulation of serine proteinases present in the brain or extravasated from the blood. Inhibitor of cathepsin G, kallikrein-8 and thrombin. May play an important role in the inner ear in the protection against leakage of lysosomal content during stress and loss of this protection results in cell death and sensorineural hearing loss.
Target Involvement
Deafness, autosomal recessive, 91 (DFNB91)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Serpin family, Ov-serpin subfamily
Target Tissue Specificity
Expressed in keratinocytes (at protein level). Highest levels in skeletal muscle. Also found in placenta, cardiac muscle, lung, liver, kidney and pancreas. Expressed in the inner ear hair cells. Expressed abundantly by normal mast cells in different tissu
Target Synonyms
CAP; Cytoplasmic antiproteinase; Peptidase inhibitor 6; PI-6; PI6; Placental thrombin inhibitor; Protease inhibitor 6 (placental thrombin inhibitor); PTI; Serpin B6; SERPINB6; SPB6_HUMAN
Target Background
The protein encoded by this gene is a member of the serpin (serine proteinase inhibitor) superfamily, and ovalbumin(ov)-serpin subfamily. It was originally discovered as a placental thrombin inhibitor. The mouse homolog was found to be expressed in the hair cells of the inner ear. Mutations in this gene are associated with nonsyndromic progressive hearing loss, suggesting that this serpin plays an important role in the inner ear in the protection against leakage of lysosomal content during stress, and that loss of this protection results in cell death and sensorineural hearing loss. Alternatively spliced transcript variants have been found for this gene.
Notification