-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SERPINC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SERPINC1 (P01008) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SERPINC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SERPINC1 (P01008) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13754A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SERPINC1 |
| Target Synonyms | AT3; AT3D; ATIII; THPH7; ATIII-R2; ATIII-T1; ATIII-T2; SERPINC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Human plasma, K-562, Mouse plasma, Rat liver, Rat plasma | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SERPINC1 (P01008). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWELSKANSRFATTFYQHLAD | Uniprot ID | P01008 |
Uniprot Id
P01008
Target Species
Human
Target Name
SERPINC1
Target Full Name
Antithrombin-III
Target Function
Most important serine protease inhibitor in plasma that regulates the blood coagulation cascade. AT-III inhibits thrombin, matriptase-3/TMPRSS7, as well as factors IXa, Xa and XIa. Its inhibitory activity is greatly enhanced in the presence of heparin.
Target Involvement
Antithrombin III deficiency (AT3D)
Target Subcellular Location
Secreted, extracellular space.
Target Protein Families
Serpin family
Target Tissue Specificity
Found in plasma.
Target Research Area
Cardiovascular
Target Synonyms
Serpin C1
Target Background
The protein encoded by this gene, antithrombin III, is a plasma protease inhibitor and a member of the serpin superfamily. This protein inhibits thrombin as well as other activated serine proteases of the coagulation system, and it regulates the blood coagulation cascade. The protein includes two functional domains: the heparin binding-domain at the N-terminus of the mature protein, and the reactive site domain at the C-terminus. The inhibitory activity is enhanced by the presence of heparin. Numerous mutations have been identified for this gene, many of which are known to cause antithrombin-III deficiency which constitutes a strong risk factor for thrombosis. A reduction in the serum level of this protein is associated with severe cases of Coronavirus Disease 19 (COVID-19).
Notification