Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SETD5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1054-1153 of human SETD5 (NP_001073986.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SETD5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1054-1153 of human SETD5 (NP_001073986.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09349A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SETD5 |
| Target Synonyms | MRD23; SETD5A; SETD5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1054-1153 of human SETD5 (NP_001073986.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PSAPQNPPQRKKVSLLEYRKRKQEAKENSAGGGGDSAQSKSKSAGAGQGSSNSVSDTGAHGVQGSSARTPSSPHKKFSPSHSSMSHLEAVSPSDSRGTSS | Uniprot ID | Q9C0A6 |
Uniprot Id
Q9C0A6
Target Species
Human
Target Name
SETD5
Target Full Name
Histone-lysine N-methyltransferase SETD5
Target Function
Chromatin regulator required for brain development: acts as a regulator of RNA elongation rate, thereby regulating neural stem cell (NSC) proliferation and synaptic transmission. May act by mediating trimethylation of 'Lys-36' of histone H3 (H3K36me3), which is essential to allow on-time RNA elongation dynamics. Also monomethylates 'Lys-9' of histone H3 (H3K9me1) in vitro. The relevance of histone methyltransferase activity is however subject to discussion.
Target Involvement
Mental retardation, autosomal dominant 23 (MRD23)
Target Subcellular Location
Nucleus. Chromosome.
Target Synonyms
SET domain containing 5; SET domain-containing protein 5; Setd5; SETD5_HUMAN
Target Background
This function of this gene has yet to be determined but based on sequence similarity to other SET domain proteins it may function as a histone methyltransferase. Mutations in this gene have been associated with an autosomal dominant form of intellectual disability. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
