Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SETD7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SETD7 (Q8WTS6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SETD7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SETD7 (Q8WTS6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16134A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SETD7 |
| Target Synonyms | KMT7; SET7; SET9; SET7/9; SETD7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Mouse brain, Mouse spleen, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SETD7 (Q8WTS6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLEGYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDT | Uniprot ID | Q8WTS6 |
Uniprot Id
Q8WTS6
Target Species
Human
Target Name
SETD7
Target Full Name
Histone-lysine N-methyltransferase SETD7
Target Function
Histone methyltransferase that specifically monomethylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Plays a central role in the transcriptional activation of genes such as collagenase or insulin. Recruited by IPF1/PDX-1 to the insulin promoter, leading to activate transcription. Has also methyltransferase activity toward non-histone proteins such as p53/TP53, TAF10, and possibly TAF7 by recognizing and binding the [KR]-[STA]-K in substrate proteins. Monomethylates 'Lys-189' of TAF10, leading to increase the affinity of TAF10 for RNA polymerase II. Monomethylates 'Lys-372' of p53/TP53, stabilizing p53/TP53 and increasing p53/TP53-mediated transcriptional activation.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
Class V-like SAM-binding methyltransferase superfamily, Histone-lysine methyltransferase family, SET7 subfamily
Target Tissue Specificity
Widely expressed. Expressed in pancreatic islets.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
FLJ21193; H3 K4 HMTase; H3-K4-HMTase SETD7; H4 lysine 4 specific; Histone H3 K4 methyltransferase; Histone H3 lysine 4 specific methyltransferase; Histone H3-K4 methyltransferase SETD7; Histone H4 K4 methyltransferase; Histone lysine N methyltransferase; Histone lysine N methyltransferase H3 lysine 4 specific SET7; Histone-lysine N-methyltransferase SETD7; KIAA1717; KMT7; Lysine methyltransferase; Lysine N-methyltransferase 7; OTTHUMP00000164543; OTTHUMP00000220049; SET 7; SET 7/9; SET 9; SET D7; SET domain containing (lysine methyltransferase) 7; SET domain containing protein 7; SET domain containing protein 8; SET domain-containing protein 7; SET7; SET7/9; SET9; Setd7; SETD7_HUMAN
Target Background
Enables histone-lysine N-methyltransferase activity and p53 binding activity. Involved in peptidyl-lysine dimethylation and peptidyl-lysine monomethylation. Acts upstream of or within cellular response to DNA damage stimulus and heterochromatin organization. Located in chromosome and nucleolus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
