Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SF3A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 715-785 of human SF3A1 (Q15459) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SF3A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 715-785 of human SF3A1 (Q15459) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08656A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SF3A1 |
| Target Synonyms | PRP21; PRPF21; SAP114; SF3A120; SF3A1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse lung, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 715-785 of human SF3A1 (Q15459). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLAL | Uniprot ID | Q15459 |
Uniprot Id
Q15459
Target Species
Human
Target Name
SF3A1
Target Full Name
Splicing factor 3A subunit 1
Target Function
Involved in pre-mRNA splicing as a component of the splicing factor SF3A complex that contributes to the assembly of the 17S U2 snRNP, and the subsequent assembly of the pre-spliceosome 'E' complex and the pre-catalytic spliceosome 'A' complex. Involved in pre-mRNA splicing as a component of pre-catalytic spliceosome 'B' complexes.
Target Subcellular Location
Nucleus. Nucleus speckle.
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
Pre mRNA processing 21; Pre mRNA splicing factor SF3a; PRP21; PRPF21; SAP 114; SAP114; sf3a1; SF3A1_HUMAN; SF3a120; Spliceosome associated protein 114; Spliceosome-associated protein 114; Splicing factor 3 subunit 1; Splicing factor 3a subunit 1 120kDa; Splicing factor 3A subunit 1
Target Background
This gene encodes a subunit of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer is a component of the mature U2 small nuclear ribonucleoprotein particle (snRNP). U2 small nuclear ribonucleoproteins play a critical role in spliceosome assembly and pre-mRNA splicing.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
