-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SF3A3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SF3A3 (Q12874) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SF3A3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SF3A3 (Q12874) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13400A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SF3A3 |
| Target Synonyms | PRP9; PRPF9; SAP61; SF3a60; SF3A3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, A-431, K-562, Mouse brain, Mouse liver, Raji | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SF3A3 (Q12874). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRKHPN | Uniprot ID | Q12874 |
Uniprot Id
Q12874
Target Species
Human
Target Name
SF3A3
Target Full Name
Splicing factor 3A subunit 3
Target Function
Involved in pre-mRNA splicing as a component of the splicing factor SF3A complex that contributes to the assembly of the 17S U2 snRNP, and the subsequent assembly of the pre-spliceosome 'E' complex and the pre-catalytic spliceosome 'A' complex. Involved in pre-mRNA splicing as a component of pre-catalytic spliceosome 'B' complexes.
Target Subcellular Location
Nucleus speckle. Nucleus.
Target Protein Families
SF3A3 family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
SF3A3; SAP61; Splicing factor 3A subunit 3; SF3a60; Spliceosome-associated protein 61; SAP 61
Target Background
This gene encodes subunit 3 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 3 interacts with subunit 1 through its amino-terminus while the zinc finger domain of subunit 3 plays a role in its binding to the 15S U2 snRNP. This gene has a pseudogene on chromosome 20. Alternative splicing results in multiple transcript variants.
Notification