Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SF3B5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SF3B5 (NP_112577.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SF3B5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SF3B5 (NP_112577.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04754A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SF3B5 |
| Target Synonyms | Ysf3; SF3b10; SF3B5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse lung, Rat spleen, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SF3B5 (NP_112577.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN | Uniprot ID | Q9BWJ5 |
Uniprot Id
Q9BWJ5
Target Species
Human
Target Name
SF3B5
Target Full Name
Splicing factor 3B subunit 5
Target Function
Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex, a constituent of the spliceosome. SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA.
Target Subcellular Location
Nucleus.
Target Protein Families
SF3B5 family
Target Synonyms
SF3B5; SF3B10; Splicing factor 3B subunit 5; SF3b5; Pre-mRNA-splicing factor SF3b 10 kDa subunit
Target Background
Enables RNA binding activity and splicing factor binding activity. Involved in mRNA splicing, via spliceosome. Located in nucleoplasm. Part of U12-type spliceosomal complex and U2-type precatalytic spliceosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
