-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SFRP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 201-300 of human SFRP4 (Q6FHJ7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SFRP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 201-300 of human SFRP4 (Q6FHJ7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16595A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SFRP4 |
| Target Synonyms | PYL; FRP-4; FRPHE; FRZB-2; sFRP-4; SFRP4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7, Rat ovary, SKOV3 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 201-300 of human SFRP4 (Q6FHJ7). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQD | Uniprot ID | Q6FHJ7 |
Uniprot Id
Q6FHJ7
Target Species
Human
Target Name
SFRP4
Target Full Name
Secreted frizzled-related protein 4
Target Function
Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP4 plays a role in bone morphogenesis. May also act as a regulator of adult uterine morphology and function. May also increase apoptosis during ovulation possibly through modulation of FZ1/FZ4/WNT4 signaling. Has phosphaturic effects by specifically inhibiting sodium-dependent phosphate uptake.
Target Involvement
Pyle disease (PYL)
Target Subcellular Location
Secreted. Note=Cytoplasmic in ovarian tumor cells.
Target Protein Families
Secreted frizzled-related protein (sFRP) family
Target Tissue Specificity
Expressed in mesenchymal cells. Highly expressed in the stroma of proliferative endometrium. Expressed in cardiomyocytes. Shows moderate to strong expression in ovarian tumors with expression increasing as the tumor stage increases. In ovarian tumors, exp
Target Synonyms
Frizzled protein; Frizzled protein human endometrium; FRP 4; FRP4; FrpHE; human endometrium; PYL; Secreted frizzled-related protein 4; sFRP-4; Sfrp4; SFRP4_HUMAN
Target Background
Secreted frizzled-related protein 4 (SFRP4) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. The expression of SFRP4 in ventricular myocardium correlates with apoptosis related gene expression.
Notification