Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SFSWAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-280 of human SFSWAP (NP_004583.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SFSWAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-280 of human SFSWAP (NP_004583.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04159A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SFSWAP |
| Target Synonyms | SWAP; SFRS8; SFSWAP | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, Jurkat, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 170-280 of human SFSWAP (NP_004583.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SKQREKNEAENLEENEEPFVAPLGLSVPSDVELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSG | Uniprot ID | Q12872 |
Uniprot Id
Q12872
Target Species
Human
Target Name
SFSWAP
Target Full Name
Splicing factor, suppressor of white-apricot homolog
Target Function
Plays a role as an alternative splicing regulator. Regulate its own expression at the level of RNA processing. Also regulates the splicing of fibronectin and CD45 genes. May act, at least in part, by interaction with other R/S-containing splicing factors. Represses the splicing of MAPT/Tau exon 10.
Target Subcellular Location
Nucleus.
Target Synonyms
SFSWAP; SFRS8; SWAP; Splicing factor; suppressor of white-apricot homolog; Splicing factor; arginine/serine-rich 8; Suppressor of white apricot protein homolog
Target Background
This gene encodes a human homolog of Drosophila splicing regulatory protein. This gene autoregulates its expression by control of splicing of its first two introns. In addition, it also regulates the splicing of fibronectin and CD45 genes. Two transcript variants encoding different isoforms have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
