-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SFTPA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 122-221 of human SFTPA1 (NP_005402.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SFTPA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 122-221 of human SFTPA1 (NP_005402.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11257A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Sftpa1 |
| Target Synonyms | SPA; ILD1; PSAP; PSPA; SP-A; SPA1; PSP-A; SFTP1; SP-A1; COLEC4; SFTPA1B; SP-A1 beta; SP-A1 delta; SP-A1 gamma; SP-A1 epsilon; SFTPA1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 122-221 of human SFTPA1 (NP_005402.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGK | Uniprot ID | Q8IWL2 |
Uniprot Id
Q8IWL2
Target Species
Human
Target Name
SFTPA1
Target Full Name
Pulmonary surfactant-associated protein A1
Target Function
In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages.; (Microbial infection) Recognition of M.tuberculosis by dendritic cells may occur partially via this molecule. Can recognize, bind, and opsonize pathogens to enhance their elimination by alveolar macrophages.
Target Involvement
Pulmonary fibrosis, idiopathic (IPF); Respiratory distress syndrome in premature infants (RDS)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, surface film.
Target Protein Families
SFTPA family
Target Research Area
Cell Biology
Target Synonyms
SFTPA1; COLEC4; PSAP; SFTP1; SFTPA; SFTPA1B; Pulmonary surfactant-associated protein A1; PSP-A; PSPA; SP-A; SP-A1; 35 kDa pulmonary surfactant-associated protein; Alveolar proteinosis protein; Collectin-4
Target Background
This gene encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants.
Notification