Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SFXN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human SFXN3 (NP_112233.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SFXN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human SFXN3 (NP_112233.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from U-87MG cells, using SFXN3 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 45s.
| Cat.No | ADA-02293A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SFXN3 |
| Target Synonyms | SFX3; SLC56A3; BA108L7.2; SFXN3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human SFXN3 (NP_112233.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDS | Uniprot ID | Q9BWM7 |
Uniprot Id
Q9BWM7
Target Species
Human
Target Name
SFXN3
Target Full Name
Sideroflexin-3
Target Function
Mitochondrial serine transporter that mediates transport of serine into mitochondria, an important step of the one-carbon metabolism pathway. Mitochondrial serine is converted to glycine and formate, which then exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors.
Target Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Target Protein Families
Sideroflexin family
Target Synonyms
SFXN3; Sideroflexin-3
Target Background
Enables serine transmembrane transporter activity. Involved in serine import into mitochondrion. Located in mitochondrion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
