-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SGOL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human SGOL1 (NP_612493.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SGOL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human SGOL1 (NP_612493.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04583A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SGOL1 |
| Target Synonyms | SGO; CAID; SGOL1; NY-BR-85 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HT-29, Mouse testis, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human SGOL1 (NP_612493.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALK | Uniprot ID | Q5FBB7 |
Uniprot Id
Q5FBB7
Target Species
Human
Target Name
SGO1
Target Full Name
Shugoshin 1
Target Function
Plays a central role in chromosome cohesion during mitosis by preventing premature dissociation of cohesin complex from centromeres after prophase, when most of cohesin complex dissociates from chromosomes arms. May act by preventing phosphorylation of the STAG2 subunit of cohesin complex at the centromere, ensuring cohesin persistence at centromere until cohesin cleavage by ESPL1/separase at anaphase. Essential for proper chromosome segregation during mitosis and this function requires interaction with PPP2R1A. Its phosphorylated form is necessary for chromosome congression and for the proper attachment of spindle microtubule to the kinetochore. Necessary for kinetochore localization of PLK1 and CENPF. May play a role in the tension sensing mechanism of the spindle-assembly checkpoint by regulating PLK1 kinetochore affinity. Isoform 3 plays a role in maintaining centriole cohesion involved in controlling spindle pole integrity. Involved in centromeric enrichment of AUKRB in prometaphase.
Target Involvement
Chronic atrial and intestinal dysrhythmia (CAID)
Target Subcellular Location
Nucleus. Chromosome, centromere. Chromosome, centromere, kinetochore. Cytoplasm, cytoskeleton, spindle pole. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
Shugoshin family
Target Tissue Specificity
Widely expressed. Highly expressed in testis. Expressed in lung, small intestine, breast, liver and placenta. Strongly overexpressed in 90% of breast cancers tested.
Target Synonyms
hSgo 1; hSgo1; NY BR 85; Serologically defined breast cancer antigen NY BR 85 ; Serologically defined breast cancer antigen NY-BR-85; SGO 1; SGO; SGO L1; SGO1; SGOL 1; SGOL1; SGOL1_HUMAN; Shugoshin 1AB protein; Shugoshin 1CD protein; Shugoshin 1EFprotein; Shugoshin 1GH protein; Shugoshin 1KL protein; Shugoshin like 1 (S. pombe); Shugoshin like 1; Shugoshin-like 1
Target Background
The protein encoded by this gene is a member of the shugoshin family of proteins. This protein is thought to protect centromeric cohesin from cleavage during mitotic prophase by preventing phosphorylation of a cohesin subunit. Reduced expression of this gene leads to the premature loss of centromeric cohesion, mis-segregation of sister chromatids, and mitotic arrest. Evidence suggests that this protein also protects a small subset of cohesin found along the length of the chromosome arms during mitotic prophase. An isoform lacking exon 6 has been shown to play a role in the cohesion of centrioles (PMID: 16582621 and PMID:18331714). Mutations in this gene have been associated with Chronic Atrial and Intestinal Dysrhythmia (CAID) syndrome, characterized by the co-occurrence of Sick Sinus Syndrome (SSS) and Chronic Intestinal Pseudo-obstruction (CIPO) within the first four decades of life (PMID:25282101). Fibroblast cells from CAID patients exhibited both increased cell proliferation and higher rates of senescence. Pseudogenes of this gene have been found on chromosomes 1 and 7. Alternative splicing results in multiple transcript variants.
Notification