-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SGTA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SGTA (NP_003012.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SGTA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SGTA (NP_003012.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00080A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SGTA |
| Target Synonyms | SGT; Vpu; SGT1; hSGT; alphaSGT; SGTA | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SGTA (NP_003012.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIEL | Uniprot ID | O43765 |
Uniprot Id
O43765
Target Species
Human
Target Name
SGTA
Target Full Name
Small glutamine-rich tetratricopeptide repeat-containing protein alpha
Target Function
Co-chaperone that binds misfolded and hydrophobic patches-containing client proteins in the cytosol. Mediates their targeting to the endoplasmic reticulum but also regulates their sorting to the proteasome when targeting fails. Functions in tail-anchored/type II transmembrane proteins membrane insertion constituting with ASNA1 and the BAG6 complex a targeting module. Functions upstream of the BAG6 complex and ASNA1, binding more rapidly the transmembrane domain of newly synthesized proteins. It is also involved in the regulation of the endoplasmic reticulum-associated misfolded protein catabolic process via its interaction with BAG6: collaborates with the BAG6 complex to maintain hydrophobic substrates in non-ubiquitinated states. Competes with RNF126 for interaction with BAG6, preventing the ubiquitination of client proteins associated with the BAG6 complex. Binds directly to HSC70 and HSP70 and regulates their ATPase activity.; (Microbial infection) In case of infection by polyomavirus, involved in the virus endoplasmic reticulum membrane penetration and infection via interaction with DNAJB12, DNAJB14 and HSPA8/Hsc70.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
SGT family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
Alpha SGT; Alpha-SGT; AlphaSGT; hSGT; SGT; Sgt1; SGTA; SGTA_HUMAN; Small glutamine rich protein with tetratricopeptide repeats 1; Small glutamine rich tetratricopeptide repeat containing protein alpha; Small glutamine rich tetratricopeptide repeat TPR containing alpha; Small glutamine rich tetratricopeptide repeat-containing protein; Small glutamine-rich tetratricopeptide repeat-containing protein alpha; Stg; UBP; Vpu binding protein; Vpu-binding protein
Target Background
This gene encodes a protein which is capable of interacting with the major nonstructural protein of parvovirus H-1 and 70-kDa heat shock cognate protein; however, its function is not known. Since this transcript is expressed ubiquitously in various tissues, this protein may serve a housekeeping function.
Notification