-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SH3GL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 219-368 of human SH3GL1 (NP_003016.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SH3GL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 219-368 of human SH3GL1 (NP_003016.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02502A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SH3GL1 |
| Target Synonyms | EEN; CNSA1; SH3P8; SH3D2B; SH3GL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat, Monkey | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | COS-7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 219-368 of human SH3GL1 (NP_003016.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ | Uniprot ID | Q99961 |
Uniprot Id
Q99961
Target Species
Human
Target Name
SH3GL1
Target Full Name
Endophilin-A2
Target Function
Implicated in endocytosis. May recruit other proteins to membranes with high curvature.
Target Involvement
In some cases of acute leukemia, a translocation results in the formation of a KMT2A/MLL1-EEN fusion gene.
Target Subcellular Location
Cytoplasm. Early endosome membrane; Peripheral membrane protein. Cell projection, podosome.
Target Protein Families
Endophilin family
Target Tissue Specificity
Ubiquitous. Higher expression in pancreas, placenta, prostate, testis and uterus.
Target Research Area
Cell Biology
Target Synonyms
CNSA1; EEN; EEN fusion partner of MLL; Endophilin-2; Endophilin-A2; Extra 11 19 leukemia fusion gene; Extra eleven-nineteen leukemia fusion gene protein; Fusion partner of MLL; MGC111371; SH3 containing Grb 2 like 1 protein; SH3 containing protein EEN; SH3 domain GRB2 like 1; SH3 domain protein 2B; SH3 domain-containing GRB2-like protein 1; SH3D2B; SH3G1_HUMAN; Sh3gl1; SH3P8
Target Background
This gene encodes a member of the endophilin family of Src homology 3 domain-containing proteins. The encoded protein is involved in endocytosis and may also play a role in the cell cycle. Overexpression of this gene may play a role in leukemogenesis, and the encoded protein has been implicated in acute myeloid leukemia as a fusion partner of the myeloid-lymphoid leukemia protein. Pseudogenes of this gene are located on the long arm of chromosomes 11 and 17. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification