-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SH3KBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 136-271 of human SH3KBP1 (NP_114098.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SH3KBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 136-271 of human SH3KBP1 (NP_114098.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09931A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SH3KBP1 |
| Target Synonyms | HSB1; AGMX2; CIN85; GIG10; HSB-1; IMD61; MIG18; CD2BP3; SH3KBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 136-271 of human SH3KBP1 (NP_114098.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDY | Uniprot ID | Q96B97 |
Uniprot Id
Q96B97
Target Species
Human
Target Name
SH3KBP1
Target Full Name
SH3 domain-containing kinase-binding protein 1
Target Function
Adapter protein involved in regulating diverse signal transduction pathways. Involved in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases, including EGFR and MET/hepatocyte growth factor receptor, through an association with CBL and endophilins. The association with CBL, and thus the receptor internalization, may be inhibited by an interaction with PDCD6IP and/or SPRY2. Involved in regulation of ligand-dependent endocytosis of the IgE receptor. Attenuates phosphatidylinositol 3-kinase activity by interaction with its regulatory subunit. May be involved in regulation of cell adhesion; promotes the interaction between TTK2B and PDCD6IP. May be involved in the regulation of cellular stress response via the MAPK pathways through its interaction with MAP3K4. Is involved in modulation of tumor necrosis factor mediated apoptosis. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape and migration. Has an essential role in the stimulation of B cell activation.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Cytoplasmic vesicle membrane; Peripheral membrane protein. Cell junction, synapse, synaptosome. Cell junction, focal adhesion.
Target Tissue Specificity
Ubiquitously expressed. Also expressed in some cancer cell lines.
Target Synonyms
c Cbl interacting protein; Cbl interacting protein; Cbl interacting protein of 85 kDa; Cbl-interacting protein of 85 kDa; CD2 binding protein 3; CD2-binding protein 3; CD2BP3; CIN 85; CIN85; GIG 10; GIG10; HSB 1; HSB-1; HSB1; Human Src family kinase binding protein 1; Human Src family kinase-binding protein 1; MIG 18; MIG18; Migration inducing gene 18; Migration inducing gene 18 protein; SH3 domain kinase binding protein 1; SH3 domain-containing kinase-binding protein 1; SH3BP 1; SH3K1_HUMAN; SH3KBP1; Src family kinase binding protein 1; src related kinase binding protein 1
Target Background
This gene encodes an adapter protein that contains one or more N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants encoding distinct isoforms.
Notification