-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SHB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human SHB (NP_003019.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SHB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human SHB (NP_003019.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05143A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SHB |
| Target Synonyms | bA3J10.2; SHB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, LO2, Mouse liver, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human SHB (NP_003019.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVD | Uniprot ID | Q15464 |
Uniprot Id
Q15464
Target Species
Human
Target Name
SHB
Target Full Name
SH2 domain-containing adapter protein B
Target Function
Adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. May play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. May also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. May also regulate IRS1 and IRS2 signaling in insulin-producing cells.
Target Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note=Associates with membrane lipid rafts upon TCR stimulation.
Target Tissue Specificity
Widely expressed.
Target Synonyms
bA3J10.2; OTTHUMP00000021397; RP11 3J10.8; RP113J10.8; SH2 domain containing adapter protein B; SH2 domain-containing adapter protein B; SHB (Src homology 2 domain containing) adaptor protein B; SHB adaptor protein (a Src homology 2 protein); SHB adaptor protein; Shb; SHB_HUMAN; Src homology 2 domain containing adaptor protein B; Src homology 2 protein
Target Background
Enables phosphotyrosine residue binding activity. Predicted to be involved in several processes, including angiogenesis; apoptotic process; and signal transduction. Predicted to act upstream of or within several processes, including hematopoietic stem cell proliferation; negative regulation of oocyte maturation; and positive regulation of immune response. Located in cytoplasmic ribonucleoprotein granule; cytosol; and nucleoplasm.
Notification