Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SHBG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-170 of human SHBG (NP_001031.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SHBG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-170 of human SHBG (NP_001031.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09323A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SHBG |
| Target Synonyms | ABP; SBP; TEBG; SHBG | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Human placenta, Mouse testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-170 of human SHBG (NP_001031.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRI | Uniprot ID | P04278 |
Uniprot Id
P04278
Target Species
Human
Target Name
SHBG
Target Full Name
Sex hormone-binding globulin
Target Function
Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration.
Target Subcellular Location
Secreted.
Target Tissue Specificity
Isoform 1 and isoform 2 are present in liver and testis.
Target Synonyms
ABP; SBP; TEBG; SHBG
Target Background
This gene encodes a steroid binding protein that was first described as a plasma protein secreted by the liver but is now thought to participate in the regulation of steroid responses. The encoded protein transports androgens and estrogens in the blood, binding each steroid molecule as a dimer formed from identical or nearly identical monomers. Polymorphisms in this gene have been associated with polycystic ovary syndrome and type 2 diabetes mellitus. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
