Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SIAE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-450 of human SIAE (NP_733746.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SIAE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-450 of human SIAE (NP_733746.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03526A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SIAE |
| Target Synonyms | LSE; AIS6; CSEC; YSG2; CSE-C; SIAE | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 270-450 of human SIAE (NP_733746.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCK | Uniprot ID | Q9HAT2 |
Uniprot Id
Q9HAT2
Target Species
Human
Target Name
SIAE
Target Full Name
Sialate O-acetylesterase
Target Function
Catalyzes the removal of O-acetyl ester groups from position 9 of the parent sialic acid, N-acetylneuraminic acid.
Target Involvement
Autoimmune disease 6 (AIS6)
Target Subcellular Location
Lysosome. Secreted.
Target Tissue Specificity
Widely expressed with high expression in the testis, prostate, and colon.
Target Synonyms
SIAE; YSG2; Sialate O-acetylesterase; EC 3.1.1.53; H-Lse; Sialic acid-specific 9-O-acetylesterase
Target Background
This gene encodes an enzyme which removes 9-O-acetylation modifications from sialic acids. Mutations in this gene are associated with susceptibility to autoimmune disease 6. Multiple transcript variants encoding different isoforms, found either in the cytosol or in the lysosome, have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
