-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SIK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SIK1 (NP_775490.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SIK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SIK1 (NP_775490.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05187A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SIK1 |
| Target Synonyms | MSK; SIK; DEE30; SIK-1; SIK1B; SNF1LK; SIK1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse stomach, SGC-7901 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SIK1 (NP_775490.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDKTRLDSSNLEKIYREVQLMKLLNHPHIIKLYQVMETKDMLY | Uniprot ID | P57059 |
Uniprot Id
P57059
Target Species
Human
Target Name
SIK1
Target Full Name
Serine/threonine-protein kinase SIK1
Target Function
Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, gluconeogenesis and lipogenesis regulation, muscle growth and differentiation and tumor suppression. Phosphorylates HDAC4, HDAC5, PPME1, SREBF1, CRTC1/TORC1. Inhibits CREB activity by phosphorylating and inhibiting activity of TORCs, the CREB-specific coactivators, like CRTC2/TORC2 and CRTC3/TORC3 in response to cAMP signaling. Acts as a tumor suppressor and plays a key role in p53/TP53-dependent anoikis, a type of apoptosis triggered by cell detachment: required for phosphorylation of p53/TP53 in response to loss of adhesion and is able to suppress metastasis. Part of a sodium-sensing signaling network, probably by mediating phosphorylation of PPME1: following increases in intracellular sodium, SIK1 is activated by CaMK1 and phosphorylates PPME1 subunit of protein phosphatase 2A (PP2A), leading to dephosphorylation of sodium/potassium-transporting ATPase ATP1A1 and subsequent increase activity of ATP1A1. Acts as a regulator of muscle cells by phosphorylating and inhibiting class II histone deacetylases HDAC4 and HDAC5, leading to promote expression of MEF2 target genes in myocytes. Also required during cardiomyogenesis by regulating the exit of cardiomyoblasts from the cell cycle via down-regulation of CDKN1C/p57Kip2. Acts as a regulator of hepatic gluconeogenesis by phosphorylating and repressing the CREB-specific coactivators CRTC1/TORC1 and CRTC2/TORC2, leading to inhibit CREB activity. Also regulates hepatic lipogenesis by phosphorylating and inhibiting SREBF1. In concert with CRTC1/TORC1, regulates the light-induced entrainment of the circadian clock by attenuating PER1 induction; represses CREB-mediated transcription of PER1 by phosphorylating and deactivating CRTC1/TORC1.
Target Involvement
Epileptic encephalopathy, early infantile, 30 (EIEE30)
Target Subcellular Location
Cytoplasm. Nucleus. Note=Locates to cytoplasm when inactive following cAMP-induced phosphorylation, probably by PKA (PubMed:29211348).
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, AMPK subfamily
Target Synonyms
KID2; MSK; myocardial SNF1 like kinase; QIK; Qin-induced kinase; Salt inducible kinase 1; Salt-inducible protein kinase 1; Serine threonine protein kinase SNF1 like kinase 1; Serine threonine protein kinase SNF1LK; Serine/threonine-protein kinase SIK1; Serine/threonine-protein kinase SNF1-like kinase 1; Serine/threonine-protein kinase SNF1LK; SIK-1; SIK1; SIK1_HUMAN; SNF1 like kinase; Snf1lk
Target Background
This gene encodes a serine/threonine protein kinase that contains a ubiquitin-associated (UBA) domain. The encoded protein is a member of the adenosine monophosphate-activated kinase (AMPK) subfamily of kinases that play a role in conserved signal transduction pathways. A mutation in this gene is associated with early infantile epileptic encephalopathy 30.
Notification