Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SIRPG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-140 of human SIRPG (NP_543006.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SIRPG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-140 of human SIRPG (NP_543006.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03891A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SIRPG |
| Target Synonyms | CD172g; SIRPB2; SIRP-B2; bA77C3.1; SIRPgamma; SIRPG | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, LO2, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 35-140 of human SIRPG (NP_543006.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEM | Uniprot ID | Q9P1W8 |
Uniprot Id
Q9P1W8
Target Species
Human
Target Name
SIRPG
Target Full Name
Signal-regulatory protein gamma
Target Function
Probable immunoglobulin-like cell surface receptor. On binding with CD47, mediates cell-cell adhesion. Engagement on T-cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell activation.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Detected in liver, and at very low levels in brain, heart, lung, pancreas, kidney, placenta and skeletal muscle. Expressed on CD4+ T-cells, CD8+ T-cells, CD56-bright natural killer (NK) cells, CD20+ cells, and all activated NK cells. Mainly present in the
Target Research Area
Immunology
Target Synonyms
D172 antigen like family member B; bA77C3.1; CD172 antigen-like family member B; CD172g; CD172g antigen; FLJ42230; RP11-77C3.2; Signal regulatory protein beta 2; Signal regulatory protein gamma; Signal-regulatory protein beta-2; Signal-regulatory protein gamma; SIRP B2; SIRP beta 2; SIRP gamma; SIRP-b2; SIRP-beta-2; SIRP-gamma; SIRPB2; SIRPG; SIRPG_HUMAN; SIRPgamma
Target Background
The protein encoded by this gene is a member of the signal-regulatory protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. Alternatively spliced transcript variants encoding different isoforms have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
