-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SIRT4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SIRT4 (NP_036372.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against SIRT4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SIRT4 (NP_036372.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-10771A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SIRT4 |
| Target Synonyms | SIR2L4; SIRT4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SIRT4 (NP_036372.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWLVTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLA | Uniprot ID | Q9Y6E7 |
Uniprot Id
Q9Y6E7
Target Species
Human
Target Name
SIRT4
Target Full Name
NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
Target Function
Acts as NAD-dependent protein lipoamidase, ADP-ribosyl transferase and deacetylase. Catalyzes more efficiently removal of lipoyl- and biotinyl- than acetyl-lysine modifications. Inhibits the pyruvate dehydrogenase complex (PDH) activity via the enzymatic hydrolysis of the lipoamide cofactor from the E2 component, DLAT, in a phosphorylation-independent manner. Catalyzes the transfer of ADP-ribosyl groups onto target proteins, including mitochondrial GLUD1, inhibiting GLUD1 enzyme activity. Acts as a negative regulator of mitochondrial glutamine metabolism by mediating mono ADP-ribosylation of GLUD1: expressed in response to DNA damage and negatively regulates anaplerosis by inhibiting GLUD1, leading to block metabolism of glutamine into tricarboxylic acid cycle and promoting cell cycle arrest. In response to mTORC1 signal, SIRT4 expression is repressed, promoting anaplerosis and cell proliferation. Acts as a tumor suppressor. Also acts as a NAD-dependent protein deacetylase: mediates deacetylation of 'Lys-471' of MLYCD, inhibiting its activity, thereby acting as a regulator of lipid homeostasis. Does not seem to deacetylate PC. Controls fatty acid oxidation by inhibiting PPARA transcriptional activation. Impairs SIRT1:PPARA interaction probably through the regulation of NAD(+) levels. Down-regulates insulin secretion.
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Sirtuin family, Class II subfamily
Target Tissue Specificity
Detected in vascular smooth muscle and striated muscle. Detected in insulin-producing beta-cells in pancreas islets of Langerhans (at protein level). Widely expressed. Weakly expressed in leukocytes and fetal thymus.
Target Synonyms
MGC130046; MGC130047; MGC57437; NAD dependent deacetylase sirtuin 4; NAD dependent protein deacetylase sirtuin 4; NAD-dependent ADP-ribosyltransferase sirtuin-4; NAD-dependent protein deacetylase sirtuin-4; NAD-dependent protein lipoamidase sirtuin-4, mitochondrial; Regulatory protein SIR2 homolog 4; Silent mating type information regulation 2 homolog; Sir 2 like 4; SIR 2 like protein 4; Sir2 like 4; SIR2 like protein 4; SIR2-like protein 4; SIR2L 4; SIR2L4; SIR4_HUMAN; SIRT 4; Sirt4; Sirtuin (silent mating type information regulation 2 homolog) 4; Sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae); Sirtuin 4; Sirtuin type 4; Sirtuin-4; Sirtuin4
Target Background
This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family.
Notification