-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SIRT5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 216-310 of human SIRT5 (NP_036373.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SIRT5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 216-310 of human SIRT5 (NP_036373.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07895A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SIRT5 |
| Target Synonyms | SIR2L5; SIRT5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HCT116, HepG2, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 216-310 of human SIRT5 (NP_036373.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS | Uniprot ID | Q9NXA8 |
Uniprot Id
Q9NXA8
Target Species
Human
Target Name
SIRT5
Target Full Name
NAD-dependent protein deacylase sirtuin-5, mitochondrial
Target Function
NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins. Activates CPS1 and contributes to the regulation of blood ammonia levels during prolonged fasting: acts by mediating desuccinylation and deglutarylation of CPS1, thereby increasing CPS1 activity in response to elevated NAD levels during fasting. Activates SOD1 by mediating its desuccinylation, leading to reduced reactive oxygen species. Activates SHMT2 by mediating its desuccinylation. Modulates ketogenesis through the desuccinylation and activation of HMGCS2. Has weak NAD-dependent protein deacetylase activity; however this activity may not be physiologically relevant in vivo. Can deacetylate cytochrome c (CYCS) and a number of other proteins in vitro such as UOX.
Target Subcellular Location
Mitochondrion matrix. Mitochondrion intermembrane space. Cytoplasm, cytosol. Nucleus. Note=Mainly mitochondrial. Also present extramitochondrially, with a fraction present in the cytosol and very small amounts also detected in the nucleus.; [Isoform 1]: Cytoplasm. Mitochondrion.; [Isoform 2]: Mitochondrion.
Target Protein Families
Sirtuin family, Class III subfamily
Target Tissue Specificity
Widely expressed.
Target Synonyms
NAD dependent deacetylase sirtuin 5 ; NAD dependent lysine demalonylase and desuccinylase sirtuin 5 mitochondrial; NAD dependent protein deacylase sirtuin 5 mitochondrial; NAD-dependent protein deacylase sirtuin-5; mitochondrial; Regulatory protein SIR2 homolog 5; Silent mating type information regulation 2 S.cerevisiae homolog 5; Sir2 like 5 ; SIR2-like protein 5; SIR2L5; SIR5_HUMAN; Sirt5; Sirtuin 5; Sirtuin type 5
Target Background
This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in multiple transcript variants.
Notification