Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SIVA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SIVA1 (NP_068355.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SIVA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SIVA1 (NP_068355.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03086A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SIVA1 |
| Target Synonyms | SIVA; CD27BP; Siva-1; Siva-2; SIVA1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, SW620 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SIVA1 (NP_068355.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET | Uniprot ID | O15304 |
Uniprot Id
O15304
Target Species
Human
Target Name
SIVA1
Target Full Name
Apoptosis regulatory protein Siva
Target Function
Induces CD27-mediated apoptosis. Inhibits BCL2L1 isoform Bcl-x(L) anti-apoptotic activity. Inhibits activation of NF-kappa-B and promotes T-cell receptor-mediated apoptosis.
Target Subcellular Location
Cytoplasm. Nucleus. Note=In the nucleus, accumulates in dot-like structures.
Target Tissue Specificity
Ubiquitous. Mostly expressed in thymus, testis, ovary, prostate, small intestine and spleen and less in colon.
Target Research Area
Cell Biology
Target Synonyms
Apoptosis regulatory protein Siva; CD27 binding (Siva) protein; CD27-binding protein; CD27BP; Siva 1 ; Siva 2; SIVA_HUMAN; Siva1
Target Background
This gene encodes an E3 ubiquitin ligase that regulates cell cycle progression, cell proliferation and apoptosis. The N-terminus of this protein binds to the cytoplasmic tail of the CD27 antigen, a member of the tumor necrosis factor receptor (TNFR) superfamily. In response to UV radiation-induced DNA damage, this protein has been shown to mediate the ubiquitination of proliferating cell nuclear antigen (PCNA), an important step in translesion DNA synthesis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
