-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SKAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SKAP2 (NP_003921.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SKAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SKAP2 (NP_003921.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03026A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SKAP2 |
| Target Synonyms | PRAP; RA70; SAPS; SCAP2; SKAP55R; SKAP-HOM; SKAP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SKAP2 (NP_003921.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKA | Uniprot ID | O75563 |
Uniprot Id
O75563
Target Species
Human
Target Name
SKAP2
Target Full Name
Src kinase-associated phosphoprotein 2
Target Function
May be involved in B-cell and macrophage adhesion processes. In B-cells, may act by coupling the B-cell receptor (BCR) to integrin activation. May play a role in src signaling pathway.
Target Subcellular Location
Cytoplasm.
Target Protein Families
SKAP family
Target Tissue Specificity
Ubiquitously expressed. Present in platelets (at protein level).
Target Synonyms
Fyn associated phosphoprotein SKAP55 homologue; MGC10411; MGC33; PRAP; Pyk2/RAFTK associated protein; Pyk2/RAFTK-associated protein; RA70; Retinoic acid-induced protein 70; SAPS; SKAP-55HOM; SKAP-HOM; skap2; SKAP2_HUMAN; SKAP55 homolog; SKAP55R; Src associated adaptor protein; Src family associated phosphoprotein 2; Src family-associated phosphoprotein 2; src kinase associated phosphoprotein of 55 related protein; Src kinase-associated phosphoprotein 2; Src kinase-associated phosphoprotein 55-related protein; Src-associated adapter protein with PH and SH3 domains
Target Background
The protein encoded by this gene shares homology with Src kinase-associated phosphoprotein 1, and is a substrate of Src family kinases. It is an adaptor protein that is thought to play an essential role in the Src signaling pathway, and in regulating proper activation of the immune system. This protein contains an amino terminal coiled-coil domain for self-dimerization, a plecskstrin homology (PH) domain required for interactions with lipids at the membrane, and a Src homology (SH3) domain at the carboxy terminus. Some reports indicate that this protein inhibits actin polymerization through interactions with actin assembly factors, and might negatively regulate the invasiveness of tumors by modulating actin assembly. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification