-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SKIL was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human SKIL (NP_005405.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SKIL was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human SKIL (NP_005405.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03649A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SKIL |
| Target Synonyms | SNO; SnoA; SnoI; SnoN; SKIL | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SKIL (NP_005405.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EMKEKFSMRSGKRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVSQSKELTKTEASKSISRQSEKAHSSGKLQKT | Uniprot ID | P12757 |
Uniprot Id
P12757
Target Species
Human
Target Name
SKIL
Target Full Name
Ski-like protein
Target Function
May have regulatory role in cell division or differentiation in response to extracellular signals.
Target Protein Families
SKI family
Target Tissue Specificity
Isoform SNON and isoform SNOA are widely expressed. Highest expression is found in skeletal muscle, followed by placenta and lung. Lowest expression in heart, brain and pancreas. Isoform SNOI expression is restricted to skeletal muscle.
Target Synonyms
OTTHUMP00000213557; OTTHUMP00000213591; OTTHUMP00000213592; OTTHUMP00000213595; SKI like; SKI like oncogene; Ski like protein; SKI like proto oncogene; Ski related oncogene; Ski related oncogene snoN; Ski related protein; Ski-like protein; Ski-related oncogene; Ski-related protein; SKIL; SKIL_HUMAN; SNO; SnoA; SnoI; SnoN
Target Background
The protein encoded by this gene is a component of the SMAD pathway, which regulates cell growth and differentiation through transforming growth factor-beta (TGFB). In the absence of ligand, the encoded protein binds to the promoter region of TGFB-responsive genes and recruits a nuclear repressor complex. TGFB signaling causes SMAD3 to enter the nucleus and degrade this protein, allowing these genes to be activated. Four transcript variants encoding three different isoforms have been found for this gene.
Notification