-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SKP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human SKP1 (NP_733779.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SKP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human SKP1 (NP_733779.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06346A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SKP1 |
| Target Synonyms | OCP2; p19A; EMC19; SKP1A; OCP-II; TCEB1L; SKP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, SW480 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human SKP1 (NP_733779.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK | Uniprot ID | P63208 |
Uniprot Id
P63208
Target Species
Human
Target Name
SKP1
Target Full Name
S-phase kinase-associated protein 1
Target Function
Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. The functional specificity of the SCF complex depends on the F-box protein as substrate recognition component. SCF(BTRC) and SCF(FBXW11) direct ubiquitination of CTNNB1 and participate in Wnt signaling. SCF(FBXW11) directs ubiquitination of phosphorylated NFKBIA. SCF(BTRC) directs ubiquitination of NFKBIB, NFKBIE, ATF4, SMAD3, SMAD4, CDC25A, FBXO5, CEP68 and probably NFKB2. SCF(SKP2) directs ubiquitination of phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. SCF(SKP2) directs ubiquitination of ORC1, CDT1, RBL2, ELF4, CDKN1A, RAG2, FOXO1A, and probably MYC and TAL1. SCF(FBXW7) directs ubiquitination of cyclin E, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. SCF(FBXW2) directs ubiquitination of GCM1. SCF(FBXO32) directs ubiquitination of MYOD1. SCF(FBXO7) directs ubiquitination of BIRC2 and DLGAP5. SCF(FBXO33) directs ubiquitination of YBX1. SCF(FBXO11) directs ubiquitination of BCL6 and DTL but does not seem to direct ubiquitination of TP53. SCF(BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF(CCNF) directs ubiquitination of CCP110. SCF(FBXL3) and SCF(FBXL21) direct ubiquitination of CRY1 and CRY2. SCF(FBXO9) directs ubiquitination of TTI1 and TELO2. SCF(FBXO10) directs ubiquitination of BCL2.
Target Protein Families
SKP1 family
Target Research Area
Cell Biology
Target Synonyms
Cyclin A/CDK2 associated p19; Cyclin A/CDK2 associated protein p19; Cyclin-A/CDK2-associated protein p19; EMC19; MGC34403; OCP 2; OCP II; OCP II protein; OCP-2; OCP-II; OCP2; OCPII; Organ of Corti protein 2; Organ of Corti protein II; OTTHUMP00000159379; OTTHUMP00000159380; OTTHUMP00000228275; OTTHUMP00000228276; OTTHUMP00000228278; OTTHUMP00000228279; OTTHUMP00000228281; p19A; p19skp1; RNA polymerase II elongation factor like protein; RNA polymerase II elongation factor like protein OCP2; RNA polymerase II elongation factor-like protein; S phase kinase associated protein 1; S phase kinase associated protein 1A; S phase kinase associated protein 1A p19A; S-phase kinase-associated protein 1; SIII; Skp 1; SKP 1A; skp1; SKP1_HUMAN; SKP1A; TCEB1L; Transcription Elongation Factor B 1 like; Transcription elongation factor B; Transcription elongation factor B SIII polypeptide 1 like
Target Background
This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7.
Notification