Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC12A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human SLC12A2 (NP_001037.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SLC12A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human SLC12A2 (NP_001037.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10981A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC12A2 |
| Target Synonyms | BSC; BSC2; CCC1; BSC-2; KILQS; NKCC1; PPP1R141; SLC12A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human SLC12A2 (NP_001037.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GEASGESEPAKGSEEAKGRFRVNFVDPAASSSAEDSLSDAAGVGVDGPNVSFQNGGDTVLSEGSSLHSGGGGGSGHHQHYYYDTHTNTYYLRTFGHNTMDAVPRIDHYRHTAAQLGEKLLRPSLAELHDELEKEPFEDGFANGEESTPTRDAVVTYTAESK | Uniprot ID | P55011 |
Uniprot Id
P55011
Target Species
Human
Target Name
SLC12A2
Target Full Name
Solute carrier family 12 member 2
Target Function
Cation-chloride cotransporter which mediates the electroneutral transport of chloride, potassium and/or sodium ions across the membrane. Plays a vital role in the regulation of ionic balance and cell volume.
Target Subcellular Location
Basolateral cell membrane; Multi-pass membrane protein.
Target Protein Families
SLC12A transporter family
Target Tissue Specificity
Expressed in many tissues.
Target Synonyms
Basolateral Na-K-Cl symporter; BSC; BSC2; Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1; mBSC2; MGC104233; NKCC1; PPP1R141; Protein phosphatase 1; regulatory subunit 141; S12A2_HUMAN; Slc12a2; sodium-potassium-chloride cotransporter 1; Solute carrier family 12 (sodium/potassium/chloride transporter); member 2; solute carrier family 12 (sodium/potassium/chloride transporters) member 2; Solute carrier family 12 member 2; sy-ns
Target Background
The protein encoded by this gene mediates sodium and chloride transport and reabsorption. The encoded protein is a membrane protein and is important in maintaining proper ionic balance and cell volume. This protein is phosphorylated in response to DNA damage. Three transcript variants encoding two different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
