Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC12A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SLC12A3 (NP_000330.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC12A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SLC12A3 (NP_000330.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07274A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC12A3 |
| Target Synonyms | NCC; TSC; NCCT; SLC12A3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Monkey | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, COS-7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SLC12A3 (NP_000330.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAELPTTETPGDATLCSGRFTISTLLSSDEPSPPAAYDSSHPSHLTHSSTFCMRTFGYNTIDVVPTYEHYANSTQPGEPRKVRPTLADLHSFLKQEGRHLHALAFDSRPSHEMTDGLVEGEAGTSSEKNPEEPVRFGWVK | Uniprot ID | P55017 |
Uniprot Id
P55017
Target Species
Human
Target Name
SLC12A3
Target Full Name
Solute carrier family 12 member 3
Target Function
Electroneutral sodium and chloride ion cotransporter. In kidney distal convoluted tubules, key mediator of sodium and chloride reabsorption. Receptor for the proinflammatory cytokine IL18. Contributes to IL18-induced cytokine production, including IFNG, IL6, IL18 and CCL2. May act either independently of IL18R1, or in a complex with IL18R1.
Target Involvement
Gitelman syndrome (GTLMNS)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.
Target Protein Families
SLC12A transporter family
Target Tissue Specificity
Predominantly expressed in the kidney (at protein level). Localizes to the distal convoluted tubules (at protein level)(PubMed:29993276). Not detected in normal aorta, but abundantly expressed in fatty streaks and advanced atherosclerotic lesions (at prot
Target Synonyms
FLJ96318; Na Cl cotransporter; Na Cl symporter; Na-Cl symporter; NaCl electroneutral thiazide sensitive cotransporter; NCC; NCCT; S12A3_HUMAN; slc12a3; Solute carrier family 12 (sodium/chloride transporters) member 3; Solute carrier family 12 member 3; Thiazide sensitive Na Cl cotransporter; Thiazide sensitive sodium chloride cotransporter; Thiazide-sensitive sodium-chloride cotransporter; TSC
Target Background
This gene encodes a renal thiazide-sensitive sodium-chloride cotransporter that is important for electrolyte homeostasis. This cotransporter mediates sodium and chloride reabsorption in the distal convoluted tubule. Mutations in this gene cause Gitelman syndrome, a disease similar to Bartter's syndrome, that is characterized by hypokalemic alkalosis combined with hypomagnesemia, low urinary calcium, and increased renin activity associated with normal blood pressure. This cotransporter is the target for thiazide diuretics that are used for treating high blood pressure. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
