Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC12A6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human SLC12A6 (NP_598408.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against SLC12A6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human SLC12A6 (NP_598408.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of U2OS cells using SLC12A6 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
| Cat.No | ADA-00026A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC12A6 |
| Target Synonyms | KCC3; ACCPN; KCC3A; KCC3B; CMT2II; SLC12A6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human SLC12A6 (NP_598408.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPTKTPQMGTFMG | Uniprot ID | Q9UHW9 |
Uniprot Id
Q9UHW9
Target Species
Human
Target Name
SLC12A6
Target Full Name
Solute carrier family 12 member 6
Target Function
Mediates electroneutral potassium-chloride cotransport. May be activated by cell swelling. May contribute to cell volume homeostasis in single cells.
Target Involvement
Agenesis of the corpus callosum, with peripheral neuropathy (ACCPN)
Target Subcellular Location
Basolateral cell membrane; Multi-pass membrane protein.
Target Protein Families
SLC12A transporter family
Target Tissue Specificity
Highly expressed in heart, brain and kidney. Detected at lower levels in skeletal muscle, placenta, lung and pancreas. Detected in umbilical vein endothelial cells. Isoform 2 is more abundant in kidney. Isoform 5 is testis specific. Expressed in the proxi
Target Synonyms
ACCPN; Electroneutral potassium-chloride cotransporter 3; Furosemide sensitive KCl cotransporter 3; Gaxp; K-Cl cotransporter 3; KCC 3; KCC 3A; KCC 3B; KCC3 A; KCC3; KCC3 B; KCC3A; KCC3B; Potassium chloride cotransporter 3; Potassium chloride cotransporter KCC3a S3; S12A6_HUMAN; SLC12 A6; SLC12A 6; SLC12A6; Solute carrier family 12 (potassium/chloride transporters); member 6; Solute carrier family 12 member 6; Solute carrier family 12; member 6
Target Background
This gene is a member of the K-Cl cotransporter (KCC) family. K-Cl cotransporters are integral membrane proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential. The proteins encoded by this gene are activated by cell swelling induced by hypotonic conditions. Alternate splicing results in multiple transcript variants encoding different isoforms. Mutations in this gene are associated with agenesis of the corpus callosum with peripheral neuropathy.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
