Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC13A4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 390-465 of human SLC13A4 (NP_036582.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC13A4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 390-465 of human SLC13A4 (NP_036582.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04126A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC13A4 |
| Target Synonyms | NAS2; SUT1; SUT-1; SLC13A4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse liver, Rat kidney, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 390-465 of human SLC13A4 (NP_036582.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WFTREPGFVPGWDSFFEKKGYRTDATVSVFLGFLLFLIPAKKPCFGKKNDGENQEHSLGTEPIITWKDFQKTMPWE | Uniprot ID | Q9UKG4 |
Uniprot Id
Q9UKG4
Target Species
Human
Target Name
SLC13A4
Target Full Name
Solute carrier family 13 member 4
Target Function
Sodium/sulfate cotransporter that mediates sulfate reabsorption in the high endothelial venules (HEV).
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
SLC13A/DASS transporter (TC 2.A.47) family, NADC subfamily
Target Tissue Specificity
Highly expressed in placenta and testis with intermediate levels in brain and lower levels in heart, thymus and liver.
Target Synonyms
Na(+)/sulfate cotransporter SUT-1; NaS2; S13A4_HUMAN; SLC13A4; Solute carrier family 13 member 4; SUT1
Target Background
Predicted to enable sodium:sulfate symporter activity. Predicted to be involved in anion transmembrane transport. Predicted to be located in plasma membrane. Predicted to be integral component of plasma membrane. Predicted to be integral component of membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
