Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC16A4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 388-487 of human SLC16A4 (NP_004687.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC16A4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 388-487 of human SLC16A4 (NP_004687.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09830A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC16A4 |
| Target Synonyms | MCT4; MCT5; SLC16A4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 388-487 of human SLC16A4 (NP_004687.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TFPLLMTYTICFAIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSFYFSGICYLLSSVSFFFVPLAERWKNSLT | Uniprot ID | O15374 |
Uniprot Id
O15374
Target Species
Human
Target Name
SLC16A4
Target Full Name
Monocarboxylate transporter 5
Target Function
Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator superfamily, Monocarboxylate porter (TC 2.A.1.13) family
Target Research Area
Metabolism
Target Synonyms
SLC16A4; MCT4; MCT5; Monocarboxylate transporter 5; MCT 5; Monocarboxylate transporter 4; MCT 4; Solute carrier family 16 member 4
Target Background
Predicted to enable monocarboxylic acid transmembrane transporter activity. Predicted to be involved in monocarboxylic acid transport. Predicted to be located in membrane. Predicted to be integral component of plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
