-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC17A5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC17A5 (NP_036566.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC17A5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC17A5 (NP_036566.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05070A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC17A5 |
| Target Synonyms | SD; AST; NSD; SLD; ISSD; VEAT; SIASD; SIALIN; SLC17A5 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse eye, Mouse skin, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC17A5 (NP_036566.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRSPVRDLARNDGEESTDRTPLLPGAPRAEAAPVCCSARYNLAILAFFGFFIVYALRVNLSVALVDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKK | Uniprot ID | Q9NRA2 |
Uniprot Id
Q9NRA2
Target Species
Human
Target Name
SLC17A5
Target Full Name
Sialin
Target Function
Transports glucuronic acid and free sialic acid out of the lysosome after it is cleaved from sialoglycoconjugates undergoing degradation, this is required for normal CNS myelination. Mediates aspartate and glutamate membrane potential-dependent uptake into synaptic vesicles and synaptic-like microvesicles. Also functions as an electrogenic 2NO(3)(-)/H(+) cotransporter in the plasma membrane of salivary gland acinar cells, mediating the physiological nitrate efflux, 25% of the circulating nitrate ions is typically removed and secreted in saliva.
Target Involvement
Salla disease (SD); Infantile sialic acid storage disorder (ISSD)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator superfamily, Sodium/anion cotransporter family
Target Tissue Specificity
Found in fetal lung and small intestine, and at lower level in fetal skin and muscle. In the adult, detected in placenta, kidney and pancreas. Abundant in the endothelial cells of tumors from ovary, colon, breast and lung, but is not detected in endotheli
Target Synonyms
AST; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; ISSD; Membrane glycoprotein HP59; NSD; S17A5_HUMAN; SD; Sialic acid storage disease; Sialin; SIASD; Slc17a5; SLD; Solute carrier family 17 (anion/sugar transportermember 5; Solute carrier family 17 member 5; Vesicular H(+)/Aspartate-glutamate cotransporter
Target Background
This gene encodes a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in this gene cause sialic acid storage diseases, including infantile sialic acid storage disorder and and Salla disease, an adult form.
Notification