Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC17A6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-582 of human SLC17A6 (NP_065079.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SLC17A6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-582 of human SLC17A6 (NP_065079.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10128A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC17A6 |
| Target Synonyms | DNPI; VGLUT2; SLC17A6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y, SKOV3, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-582 of human SLC17A6 (NP_065079.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS | Uniprot ID | Q9P2U8 |
Uniprot Id
Q9P2U8
Target Species
Human
Target Name
SLC17A6
Target Full Name
Vesicular glutamate transporter 2
Target Function
Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate. Involved in the regulation of retinal hyaloid vessel regression during postnatal development.
Target Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome.
Target Protein Families
Major facilitator superfamily, Sodium/anion cotransporter family, VGLUT subfamily
Target Tissue Specificity
Predominantly expressed in adult brain. Expressed in amygdala, caudate nucleus, cerebral cortex, frontal lobe, hippocampus, medulla, occipital lobe, putamen, spinal cord, substantia nigra, subthalamic nucleus, temporal lobe and thalamus.
Target Synonyms
Differentiation associated BNPI; Differentiation associated Na dependent inorganic phosphate cotransporter; Differentiation associated Na(+) dependent inorganic phosphate cotransporter; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; DNPI; SLC17A6; Sodium dependent inorganic phosphate cotransporter; Solute carrier family 17 (Sodium dependent inorganic phosphate cotransporter) member 6; Solute carrier family 17 member 6; Vesicular glutamate transporter 2; Vesicular glutamate transporter type 2; VGLU2_HUMAN; VGLUT 2; VGluT2
Target Background
Predicted to enable L-glutamate transmembrane transporter activity and neurotransmitter transmembrane transporter activity. Involved in neurotransmitter loading into synaptic vesicle. Predicted to be located in synaptic vesicle. Predicted to be active in excitatory synapse. Predicted to be integral component of synaptic vesicle membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
