Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC18A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 473-532 of human SLC18A3 (NP_003046.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against SLC18A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 473-532 of human SLC18A3 (NP_003046.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
Immunohistochemistry analysis of SLC18A3 in paraffin-embedded rat brain using SLC18A3 Rabbit pAb at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-04658A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC18A3 |
| Target Synonyms | CMS21; VACHT; SLC18A3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 473-532 of human SLC18A3 (NP_003046.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GLLTRSRSERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS | Uniprot ID | Q16572 |
Uniprot Id
Q16572
Target Species
Human
Target Name
SLC18A3
Target Full Name
Vesicular acetylcholine transporter
Target Function
Involved in acetylcholine transport into synaptic vesicles.
Target Involvement
Myasthenic syndrome, congenital, 21, presynaptic (CMS21)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator superfamily, Vesicular transporter family
Target Tissue Specificity
Peripheral and central cholinergic nervous systems.
Target Synonyms
AChR; MGC12716; rVAT; Slc18a3; Solute carrier family 18 (vesicular acetylcholine) member 3; Solute carrier family 18 (vesicular monoamine) member 3; Solute carrier family 18 member 3; VAChT; VACHT_HUMAN; Vesicular acetylcholine transporter
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
