Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC1A7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 480-560 of human SLC1A7 (NP_006662.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC1A7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 480-560 of human SLC1A7 (NP_006662.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of Mouse eye, using SLC1A7 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
| Cat.No | ADA-06457A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC1A7 |
| Target Synonyms | AAAT; EAAT5; SLC1A7 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 480-560 of human SLC1A7 (NP_006662.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DFARDTGTEKLLPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPTCPHHVPVQVEQDEELPAASLNHCTIQISELETNV | Uniprot ID | O00341 |
Uniprot Id
O00341
Target Species
Human
Target Name
SLC1A7
Target Full Name
Excitatory amino acid transporter 5
Target Function
Transports L-glutamate; the L-glutamate uptake is sodium- and voltage-dependent and chloride-independent. Its associated chloride conductance may participate in visual processing.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A7 subfamily
Target Tissue Specificity
Expressed primarily in retina. Detectable in liver, heart, muscle and brain.
Target Synonyms
AAAT; EAA5_HUMAN; EAAT5; Excitatory amino acid transporter 5 (retinal glutamate transporter); Excitatory amino acid transporter 5; FLJ36602; Retinal glutamate transporter; Slc1a7; Solute carrier family 1 (glutamate transporter) member 7; Solute carrier family 1 member 7
Target Background
Predicted to enable anion transmembrane transporter activity. Involved in neurotransmitter reuptake. Predicted to be located in plasma membrane. Predicted to be active in glutamatergic synapse. Predicted to be integral component of postsynaptic membrane and integral component of presynaptic membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
