Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC22A15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 443-547 of human SLC22A15 (NP_060890.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC22A15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 443-547 of human SLC22A15 (NP_060890.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05661A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC22A15 |
| Target Synonyms | FLIPT1; PRO34686; SLC22A15 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 443-547 of human SLC22A15 (NP_060890.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RVGGIIAPFIPSLKYVQWSLPFIVFGATGLTSGLLSLLLPETLNSPLLETFSDLQVYSYRRLGEEALSLQALDPQQCVDKESSLGSESEEEEEFYDADEETQMIK | Uniprot ID | Q8IZD6 |
Uniprot Id
Q8IZD6
Target Species
Human
Target Name
SLC22A15
Target Full Name
Solute carrier family 22 member 15
Target Function
Probably transports organic cations. Appears not to be the agmatine transporter.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator (TC 2.A.1) superfamily, Organic cation transporter (TC 2.A.1.19) family
Target Tissue Specificity
Expressed at highest levels in kidney and brain. Expressed at high levels in skeletal muscle, heart, liver, placenta and white blood cells. Expressed at moderate levels in lung and spleen. Expressed at low levels in thymus, small intestine and colon. Expr
Target Synonyms
SLC22A15; FLIPT1; UNQ9429/PRO34686; Solute carrier family 22 member 15; Fly-like putative transporter 1; Flipt 1
Target Background
Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
