-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC22A3/OCT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-450 of human SLC22A3/OCT3 (O75751) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SLC22A3/OCT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-450 of human SLC22A3/OCT3 (O75751) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14306A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC22A3/OCT3 |
| Target Synonyms | EMT; EMTH; OCT3; SLC22A3/OCT3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, PC-3 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 301-450 of human SLC22A3/OCT3 (O75751). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFTSAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVACLVTAFLPEGIAWLRTTVATLGRLGITMAF | Uniprot ID | O75751 |
Uniprot Id
O75751
Target Species
Human
Target Name
SLC22A3
Target Full Name
Solute carrier family 22 member 3
Target Function
Mediates potential-dependent transport of a variety of organic cations. May play a significant role in the disposition of cationic neurotoxins and neurotransmitters in the brain.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator (TC 2.A.1) superfamily, Organic cation transporter (TC 2.A.1.19) family
Target Tissue Specificity
Expressed in placenta, skeletal muscle, prostate, aorta, liver, fetal lung, salivary gland, adrenal gland, kidney and brain cortex. No expression detected in spleen.
Target Synonyms
SLC22A3; EMTH; OCT3; Solute carrier family 22 member 3; Extraneuronal monoamine transporter; EMT; Organic cation transporter 3
Target Background
Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein.
Notification