Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC23A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human SLC23A2 (NP_005107.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC23A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human SLC23A2 (NP_005107.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12110A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC23A2 |
| Target Synonyms | NBTL1; SVCT2; YSPL2; SLC23A1; SLC23A2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F, Neuro-2a | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human SLC23A2 (NP_005107.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQDNEDTELMAIYTTENGIAEKSSLAETLDSTGSLDPQRSDMIYTIEDVPP | Uniprot ID | Q9UGH3 |
Uniprot Id
Q9UGH3
Target Species
Human
Target Name
SLC23A2
Target Full Name
Solute carrier family 23 member 2
Target Function
Sodium/ascorbate cotransporter. Mediates electrogenic uptake of vitamin C, with a stoichiometry of 2 Na(+) for each ascorbate.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Xanthine/uracil permease family, Nucleobase:cation symporter-2 (NCS2) (TC 2.A.40) subfamily
Target Tissue Specificity
Ubiquitous.
Target Synonyms
SLC23A2; KIAA0238; NBTL1; SLC23A1; SVCT2; YSPL2; Solute carrier family 23 member 2; Na(+)/L-ascorbic acid transporter 2; Nucleobase transporter-like 1 protein; Sodium-dependent vitamin C transporter 2; hSVCT2; Yolk sac permease-like molecule 2
Target Background
The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
