-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC25A12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SLC25A12 (NP_003696.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC25A12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SLC25A12 (NP_003696.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09215A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC25A12 |
| Target Synonyms | AGC1; DEE39; ARALAR; EIEE39; SLC25A12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart, B cells, Mouse brain, Mouse liver, Raji, SKOV3, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SLC25A12 (NP_003696.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVADQTKDGLISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFENVKEIFGQTIIHHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGL | Uniprot ID | O75746 |
Uniprot Id
O75746
Target Species
Human
Target Name
SLC25A12
Target Full Name
Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial
Target Function
Mitochondrial and calcium-binding carrier that catalyzes the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate across the mitochondrial inner membrane. May have a function in the urea cycle.
Target Involvement
Epileptic encephalopathy, early infantile, 39 (EIEE39)
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Mitochondrial carrier (TC 2.A.29) family
Target Tissue Specificity
Expressed predominantly in the heart and skeletal muscle, weakly in brain and kidney.
Target Synonyms
SLC25A12; ARALAR1; Calcium-binding mitochondrial carrier protein Aralar1; Mitochondrial aspartate glutamate carrier 1; Solute carrier family 25 member 12
Target Background
This gene encodes a calcium-binding mitochondrial carrier protein. The encoded protein localizes to the mitochondria and is involved in the exchange of aspartate for glutamate across the inner mitochondrial membrane. Polymorphisms in this gene may be associated with autism, and mutations in this gene may also be a cause of global cerebral hypomyelination. Alternatively spliced transcript variants have been observed for this gene.
Notification