-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC25A14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-200 of human SLC25A14 (NP_001269124.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC25A14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-200 of human SLC25A14 (NP_001269124.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10280A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC25A14 |
| Target Synonyms | UCP5; BMCP1; SLC25A14 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-200 of human SLC25A14 (NP_001269124.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGV | Uniprot ID | O95258 |
Uniprot Id
O95258
Target Species
Human
Target Name
SLC25A14
Target Full Name
Brain mitochondrial carrier protein 1
Target Function
Participates in the mitochondrial proton leak measured in brain mitochondria.
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Mitochondrial carrier (TC 2.A.29) family
Target Tissue Specificity
Mainly expressed in brain. Some expression in testis and pituitary.
Target Synonyms
SLC25A14; BMCP1; UCP5; UNQ791/PRO1682; Brain mitochondrial carrier protein 1; BMCP-1; Mitochondrial uncoupling protein 5; UCP 5; Solute carrier family 25 member 14
Target Background
Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). Uncoupling proteins separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. Uncoupling proteins facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. This gene is widely expressed in many tissues with the greatest abundance in brain and testis. Alternative splicing results in multiple transcript variants. A pseudogene of this gene has been defined on chromosome 4.
Notification