-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC25A23 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human SLC25A23 (NP_077008.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SLC25A23 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human SLC25A23 (NP_077008.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05699A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC25A23 |
| Target Synonyms | APC2; MCSC2; SCAMC3; SCaMC-3; SLC25A23 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, 293T, Mouse brain, Mouse pancreas, Mouse testis, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human SLC25A23 (NP_077008.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHS | Uniprot ID | Q9BV35 |
Uniprot Id
Q9BV35
Target Species
Human
Target Name
SLC25A23
Target Full Name
Mitochondrial adenyl nucleotide antiporter SLC25A23
Target Function
Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria. Acts as a regulator of mitochondrial calcium uptake via interaction with MCU and MICU1.
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Mitochondrial carrier (TC 2.A.29) family
Target Tissue Specificity
Present in various cell lines (at protein level). Expressed at low levels in most tissues examined, with highest expression in brain, skeletal muscle and pancreas.
Target Synonyms
SLC25A23; APC2; MCSC2; SCAMC3; Calcium-binding mitochondrial carrier protein SCaMC-3; Mitochondrial ATP-Mg/Pi carrier protein 2; Mitochondrial Ca(2+-dependent solute carrier protein 2; Small calcium-binding mitochondrial carrier protein 3; Solute carrier family 25 member 23
Target Background
Predicted to enable ATP transmembrane transporter activity. Involved in calcium import into the mitochondrion; positive regulation of mitochondrial calcium ion concentration; and regulation of cellular hyperosmotic salinity response. Located in mitochondrion.
Notification