-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC25A26 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 105-185 of human SLC25A26 (NP_775742.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC25A26 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 105-185 of human SLC25A26 (NP_775742.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04971A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC25A26 |
| Target Synonyms | SAMC; COXPD28; SLC25A26 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 105-185 of human SLC25A26 (NP_775742.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IRVPSEVVKQRAQVSASTRTFQIFSNILYEEGIQGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHVVDSWQSAVC | Uniprot ID | Q70HW3 |
Uniprot Id
Q70HW3
Target Species
Human
Target Name
SLC25A26
Target Full Name
Mitochondrial S-adenosylmethionine carrier protein
Target Function
Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. Specifically mediates the transport of S-adenosylmethionine (SAM) into the mitochondria.
Target Involvement
Combined oxidative phosphorylation deficiency 28 (COXPD28)
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Mitochondrial carrier (TC 2.A.29) family
Target Tissue Specificity
Widely expressed. Highly expressed in testis, with moderate expression in brain, heart, kidney, lung, skeletal muscle, pancreas, small intestine and liver, and low expression in spleen.
Target Synonyms
SLC25A26; SAMC; S-adenosylmethionine mitochondrial carrier protein; Mitochondrial S-adenosylmethionine transporter; Solute carrier family 25 member 26
Target Background
This gene is a member of the mitochondrial carrier family which includes nuclear-encoded transporters localized on the inner mitochondrial membranes. Members of the family transport important small molecules across the mitochondrial inner membrane. This protein is involved in the transport of S-adenosylmethionine (SAM) into the mitochondria. Mutations in this gene are associated with combined oxidative phosphorylation deficiency 28. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification